In vitro antihistamine-releasing activity of a peptide derived from wasp venom of Vespa orientalis

نویسندگان
چکیده

برای دانلود باید عضویت طلایی داشته باشید

برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

A novel bioactive peptide from wasp venom

Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...

متن کامل

Evaluation of effects of photooxidized Vespa orientalis venom on memory and learning in rats

Wasp venom is mixture of complex proteins that have several physical and pharmacological properties. The photochemical detoxification of Vespa orientalis venom is expected to generate photooxidized venom sac extract (PVSE). Antigenically active PVSE is obtained by exposing the venom sac extract (VSE) of Vespa orientalis to ultraviolet radiation in the presence of methylene blue. The aim of the ...

متن کامل

comparison of catalytic activity of heteropoly compounds in the synthesis of bis(indolyl)alkanes.

heteropoly acids (hpa) and their salts have advantages as catalysts which make them both economically and environmentally attractive, strong br?nsted acidity, exhibiting fast reversible multi-electron redox transformations under rather mild conditions, very high solubility in polar solvents, fairly high thermal stability in the solid states, and efficient oxidizing ability, so that they are imp...

15 صفحه اول

from linguistics to literature: a linguistic approach to the study of linguistic deviations in the turkish divan of shahriar

chapter i provides an overview of structural linguistics and touches upon the saussurean dichotomies with the final goal of exploring their relevance to the stylistic studies of literature. to provide evidence for the singificance of the study, chapter ii deals with the controversial issue of linguistics and literature, and presents opposing views which, at the same time, have been central to t...

15 صفحه اول

Some Effects from Stinging by a Hornet (Vespa Orientalis)

Sik,?I publish the following cases as I believe them to be quite unusual. Case /.?A sepoy of the 33rd Sikhs was stung in the axilla at about 8 p.m. on 1st September. In about one minute he fell down in a semi-conscious condition and was immediately carried to hospital on a charpoy. On arrival he was pale and somewhat cyanosed, was sweating, the pupils were contracted and the extremities were co...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

ژورنال

عنوان ژورنال: Asian Pacific Journal of Tropical Biomedicine

سال: 2016

ISSN: 2221-1691

DOI: 10.1016/j.apjtb.2015.12.001